Search results for "heat transport"

showing 8 items of 8 documents

The European DEMO fusion reactor: Design status and challenges from balance of plant point of view

2017

DEMO initial conceptual design studies are being conducted in Europe as part of the European Union Roadmap to Fusion Electricity, which aims to demonstrate the feasibility of electricity produced by nuclear fusion reactors around the middle of this century. The aim of this paper is to provide an overview of the DEMO project, highlighting its main characteristics and challenges in terms of design, integration, and operation. Particular emphasis is given on some important systems of the Balance of Plant (BoP), such as the primary heat transfer systems, the related power conversion systems, and the electrical power plant. The relevance of such systems is due to the need of a continuous reanaly…

EngineeringElectrical Power SystemsTokamakMechanical engineeringPower Conversion System (PCS)01 natural sciences7. Clean energy010305 fluids & plasmasElectric power systemConceptual designITER0103 physical sciencesmedia_common.cataloged_instanceRelevance (information retrieval)European union010306 general physicsmedia_commonPoint (typography)business.industryElectrical Power SystemFusion powerEU-DEMOPrimary Heat Transport System (PHTS)13. Climate actionSystems engineeringNuclear fusionElectricityElectric powerNuclear fusion;Power Conversion System (PCS);Electrical Power Systems;Tokamak;EU-DEMO;Primary Heat Transport System (PHTS);ITERbusiness
researchProduct

A non-local model of thermal energy transport: The fractional temperature equation

2013

Abstract Non-local models of thermal energy transport have been used in recent physics and engineering applications to describe several “small-scale” and/or high frequency thermodynamic processes as shown in several engineering and physics applications. The aim of this study is to extend a recently proposed fractional-order thermodynamics ( [5] ), where the thermal energy transfer is due to two phenomena: A short-range heat flux ruled by a local transport equation; a long-range thermal energy transfer that represents a ballistic effects among thermal energy propagators. Long-range thermal energy transfer accounts for small-scale effects that are assumed proportional to the product of the in…

Fluid Flow and Transfer ProcessesPhysicsField (physics)business.industryMechanical EngineeringNon-local thermal energy transportFractional calculuCondensed Matter PhysicsThermal conductionFractional calculusTemperature fieldLong-range heat transportHeat fluxGeneralized entropyHeat transferStatistical physicsSettore ICAR/08 - Scienza Delle CostruzioniConvection–diffusion equationbusinessSettore MAT/07 - Fisica MatematicaThermal energyThermodynamic processInternational Journal of Heat and Mass Transfer
researchProduct

Nanowires: A route to efficient thermoelectric devices

2019

Miniaturization of electronic devices aims at manufacturing ever smaller products, from mesoscopic to nanoscopic sizes. This trend is challenging because the increased levels of dissipated power demands a better understanding of heat transport in small volumes. A significant amount of the consumed energy in electronics is transformed into heat and dissipated to the environment. Thermoelectric materials offer the possibility to harness dissipated energy and make devices less energy-demanding. Heat-to-electricity conversion requires materials with a strongly suppressed thermal conductivity but still high electronic conduction. Nanowires can meet nicely these two requirements because enhanced …

Materials scienceNanowireFOS: Physical sciences02 engineering and technology01 natural sciencesThermal conductivityMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesThermoelectric effectMiniaturizationElectronicsThermoelectric nanowires010306 general physicsPhonon scatteringCondensed Matter - Mesoscale and Nanoscale PhysicsHeat transport021001 nanoscience & nanotechnologyCondensed Matter PhysicsThermal conductionThermoelectric materialsEngineering physicsAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic MaterialsHeat to current conversion0210 nano-technology
researchProduct

Electron-phonon heat transport and electronic thermal conductivity in heavily doped silicon-on-insulator film

2003

Electron–phonon interaction and electronic thermal conductivity have been investigated in heavily doped silicon at subKelvin temperatures. The heat flow between electron and phonon systems is found to be proportional to T6. Utilization of a superconductor–semiconductor–superconductor thermometer enables a precise measurement of electron and substrate temperatures. The electronic thermal conductivity is consistent with the Wiedemann–Franz law. Peer reviewed

Materials scienceSiliconPhononphononsGeneral Physics and AstronomySilicon on insulatorchemistry.chemical_elementSubstrate (electronics)dopingsuperconductorsCondensed Matter::Materials ScienceThermal conductivityCondensed Matter::Superconductivitythermal conductivitySOICondensed matter physicsPhysicsDopingelectronsThermal conductionCondensed Matter::Mesoscopic Systems and Quantum Hall EffectWiedemann-Franz lawsilicon-on-insulatorchemistryelectron-phonon interactionssilicon dopingelemental semiconductorsWiedemann–Franz lawheat transportheavily doped semiconductors
researchProduct

Phononic heat transport in the transient regime: An analytic solution

2016

We investigate the time-resolved quantum transport properties of phonons in arbitrary harmonic systems connected to phonon baths at different temperatures. We obtain a closed analytic expression of the time-dependent one-particle reduced density matrix by explicitly solving the equations of motion for the nonequilibrium Green's function. This is achieved through a well-controlled approximation of the frequency-dependent bath self-energy. Our result allows for exploring transient oscillations and relaxation times of local heat currents, and correctly reduces to an earlier known result in the steady-state limit. We apply the formalism to atomic chains, and benchmark the validity of the approx…

PhononEnergy dispersionphononsFOS: Physical sciencesNon-equilibrium thermodynamics02 engineering and technology01 natural sciencesSettore FIS/03 - Fisica della MateriaQuantum transportMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesElectronicOptical and Magnetic Materials010306 general physicsquantum transportfononitElectronic Optical and Magnetic Materials; Condensed Matter PhysicsPhysicsCondensed Matter - Mesoscale and Nanoscale PhysicsAnalytical expressionsta114Equations of motionCondensed Matter Physics021001 nanoscience & nanotechnologyClassical mechanicsReduced density matrix0210 nano-technologyAnalytic solutionheat transport
researchProduct

The finite element method for fractional non-local thermal energy transfer in non-homogeneous rigid conductors

2015

Abstract In a non-local fractional-order model of thermal energy transport recently introduced by the authors, it is assumed that local and non-local contributions coexist at a given observation scale: while the first is described by the classical Fourier transport law, the second involves couples of adjacent and non-adjacent elementary volumes, and is taken as proportional to the product of the masses of the interacting volumes and their relative temperature, through a material-dependent, distance-decaying power-law function. As a result, a fractional-order heat conduction equation is derived. This paper presents a pertinent finite element method for the solution of the proposed fractional…

PhysicsFinite element methodNumerical Analysisbusiness.industryApplied MathematicsMathematical analysisFinite differenceFinite element method; Fractional calculus; Long-range heat transport; Non-homogeneous conductors; Modeling and Simulation; Numerical Analysis; Applied MathematicsMixed finite element methodFractional calculuFinite element methodFractional calculussymbols.namesakeLong-range heat transportFourier transformModeling and SimulationsymbolsHeat equationNon-homogeneous conductorbusinessSettore ICAR/08 - Scienza Delle CostruzioniNumerical AnalysiThermal energyExtended finite element method
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Implementing the 3-omega technique for thermal conductivity measurements

2013

Thermal conductivity of the constituent materials is one of the most important properties affecting the performance of micro- and nanofabricated devices. These devices often make use of thin films with thicknesses ranging from some nanometers to few micrometers. The thermal conductivity of thin films can be measured with the three-omega method. In three-omega technique a metal wire acting as a resistive heater is microfabricated on the sample. Alternating current passing through the metal heater at a frequency ω heats the sample periodically and generates oscillations in the resistance of the metal line at a frequency 2ω. The oscillating resistance component is coupled with the driving curr…

thin filmlämmön johtuminen3-omegathermal conductivityfysiikkaheat transport
researchProduct